PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000257129
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 365aa    MW: 41251.1 Da    PI: 7.2709
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000257129genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.61.3e-33202259259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp++v++tYeg+Hnh+
  MDP0000257129 202 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCNVKKRVERSFQDPSIVITTYEGQHNHQ 259
                    8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.1E-35186261IPR003657WRKY domain
SuperFamilySSF1182902.62E-29194261IPR003657WRKY domain
PROSITE profilePS5081132.168196261IPR003657WRKY domain
SMARTSM007741.7E-39201260IPR003657WRKY domain
PfamPF031062.7E-26202259IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MSNERKNPYQ YDPFDYNHHE INKSSFPFFN YGNSSTYQNQ PDDPQTLNGF ESDHPNPFMS  60
FTDCLHGSLD YNTLSKAFDM SCSSSEVISP PLDHDNNSNK QQAAAGVRDH SVGTTSTTEN  120
PSTPNYSSIS SSSNEAAGAA GDDQVLDEDS DHKRKKDKQP KLGSDGVHED KSKKGSKAKK  180
KEKPQREPRF AFLTKSEVDH LEDGYRWRKY GQKAVKNSPY PRSYYRCTTQ KCNVKKRVER  240
SFQDPSIVIT TYEGQHNHQC PAATLRGNLN LNAVGMLSPN SLLAAASLNG SARYSHEFLA  300
QFFPVNNQVQ LPNHFHDHPP SSMLYSNLMN PHSHHHHQQQ QQQLHAPDYG LLQDLVHSFS  360
HKQEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-291942621078Probable WRKY transcription factor 4
1wj2_A2e-291942621078Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008342352.10.0PREDICTED: probable WRKY transcription factor 71
TrEMBLM5XJ161e-156M5XJ16_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s22480.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22313483
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.15e-53WRKY DNA-binding protein 28